SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007592 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007592
Domain Number 1 Region: 30-125
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-23
Family I set domains 0.0036
Further Details:      
 
Domain Number 2 Region: 127-217
Classification Level Classification E-value
Superfamily Immunoglobulin 5.23e-17
Family I set domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007592   Gene: ENSNLEG00000006250   Transcript: ENSNLET00000007961
Sequence length 263
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:36889607:36899965:-1 gene:ENSNLEG00000006250 transcript:ENSNLET00000007961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMLILQLLTLWPLCHTDITPSVPPASYYPKPWLGAQPATVVTPGVNVTLRCRAPQPAW
RFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDALE
LLVTEKLPRPSLVALPGPVVAPGANLSLRCAGRLRNMSFVLYREGVAAPLQYRDSAQPWA
DFPLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTQGNLVRLGLAGLVL
ISLGALVTFDWRSQNRAPAGIRP
Download sequence
Identical sequences ENSNLEP00000007592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]