SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007605 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007605
Domain Number 1 Region: 1438-1658
Classification Level Classification E-value
Superfamily SET domain 3.14e-69
Family Histone lysine methyltransferases 0.00082
Further Details:      
 
Domain Number 2 Region: 2359-2393
Classification Level Classification E-value
Superfamily WW domain 0.0000000025
Family WW domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007605
Domain Number - Region: 1255-1311
Classification Level Classification E-value
Superfamily Ferritin-like 0.000365
Family Ribonucleotide reductase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007605   Gene: ENSNLEG00000006252   Transcript: ENSNLET00000007974
Sequence length 2535
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:35285830:35400507:-1 gene:ENSNLEG00000006252 transcript:ENSNLET00000007974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKIENVQKTGFIKGPMFKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFL
TALGNEKQSDTPNPPAVPLQVDSTPKMKMEIGDTLPAAEESSPPKSRVELGKIHFKKHLL
HVTSRPLLATTTAVASPPTHAAPLPAVTAESTTVDSPPSSPPPPPPPFQATTLSSPAPVT
EPVALPHTPITVLMAAPVPLPVDVAVRSLKEPPIIIVPESLEAGTKQDTVSNSSEEHIIQ
ILNEQADISSKKEDSHIGKDEEIPDSSKINLSCKKTGSKKKSSQSEGTFLGSESDEDSVR
TSSSQKSHDLKFSASIEKERDFKKSSAPLKSEDLGKSSRSKTDRDDKYFSYSKLERDTRY
VSSRCRSERERRRSRSHSRSERGSRTNLSYSRSERSHYYDSDRRYHRSSPYRERTRYSRP
YADNRARESSDSEEEYKKTYSRRTSSHSSSYRDLRTSSYSKSDRDCKTETSYLEMERRGK
YSSKLERESKRTSENEAIKRCCSPPNELGFRRGSSYSKHDSSASRYKSTLSKPIPKSDKF
KNSFCCTELNEEMKQSHSFSLQTPCSKGSELRMINKNPEREKAGSPAPSNRLNDSPTLKK
LDELPIFKSEFITHDSHDGIKELDSLSKVKNDQLRSFCPIELNINGSPGAESDLATFCTS
KTDAVLMTSDDSVTGSELSPLVKACMLSSNGFQNVSRCKEKDLDDTCMLHKKSESPFRET
EPLVSPHQDKLMSLPVMTIDYSKTVVKEPVDTRVSCCKTKDSDIYCTSNDSNPSLCNSEA
ENIEPSVMKISSNSFMNMHLESKPVICDSRNLTDHSKFACEEYKQSIGSTSSASVNHFDD
LYQPIGSSGIASSLQSLPPGIKVDSLTLLKCGENTSPVLDAVLKSKKSSEFLKHAGKETI
VEVGSDLPDSGKGFVSRENRRNNGLSGKCLQEAQEEGNSILPERRGRPEISLDERGEGGR
VHTSDDSEVVFSSCDLNLTVEDSDGVTYALRCDSSGHAPEIVSTVHEDYSGSSESSNDES
DSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYRHYSDHWEDERLESR
RHSYEEKFESIASKACPQTDKFFLHKGTEKNLEISFTQSSRKQIDNHLPELSHPQSDGVD
STSHTDVKSDPLGHPNSEETVKAKISSRQQEELPIYSSDFEDVPNKSWQQATFQNRPDSR
LGKTELSFSSSCEISRVDVLHSSEELRNLGWDFSQEKPSTTYQQPDSSYGACGGHKYQQN
TEQYGGTRDYWQGNGYWDPRPGRPPGTGVVYDRTQGQVPDSLTDDREEEENWDQQDGSHF
SDQSNKFLLSLQKDKGSVQAPEISSNSIKDTLAVNEKKDFSKNLEKNDIKDRGPLKKRRQ
EIESDSESDGELQDRKKVRVEVEQGETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKM
PCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIEC
SSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEF
KARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVG
FFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERS
RKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLELIQNTHSQSCLKS
FLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQ
TKTAVPPLSEGDGYSSENTSRAHTPLNTPDPFTKLSTEADTDTPKKLMFRRLKIISENSM
DSAISDATSELEGKDGKEDLDQLENVPVEEEEELQSQQLLPQQLPECKVDSETNVEAKKI
PTREAEEGELLEPRSRDGAGLELPTSGDPPTSASQSAGIMGVNISQILENNFKAITISTL
TNNLPLVYFLQEVYRIPKKSQTEKENTTTERGRDAVGFRDQTPAPKTPNRSRERDPDKQT
QNKEKRKRRSSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEV
AQREAQKQQQQMQNLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLL
PTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVAQSDGVVH
QDSSVAVLPVPAPGPVQGQNYSVWDSNQQSVSVQQQYSPAQSQATIYYQGQTCPTVYGVT
SPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPAAAVTTIVAPGQPQPLQPSEM
VVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDA
SLEHEAEMDLGTPTYDENPMKASKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPY
RKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQ
KFGAVYKPKEDTELE
Download sequence
Identical sequences ENSNLEP00000007605 ENSNLEP00000007605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]