SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007638 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007638
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 1.07e-48
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000118
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007638   Gene: ENSNLEG00000006285   Transcript: ENSNLET00000008007
Sequence length 635
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:5787044:5790084:1 gene:ENSNLEG00000006285 transcript:ENSNLET00000008007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPV
NLQHLILSGNQLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPAPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEA
TARVELRVLALPHGGNTSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRL
GGAWARRSHSVHGGLLGAGCRGVGGSAERLEESVV
Download sequence
Identical sequences A0A096N284 A0A2K5L840 A0A2K5VQG8 G1R366 I2CYV4
ENSNLEP00000007638 ENSNLEP00000007638 XP_003273962.1.23891 XP_005577166.1.63531 XP_011896894.1.92194 XP_011896895.1.92194 ENSPANP00000006427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]