SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007651 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007651
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-21
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.35e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007651   Gene: ENSNLEG00000006287   Transcript: ENSNLET00000008020
Sequence length 345
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:22929237:23149334:-1 gene:ENSNLEG00000006287 transcript:ENSNLET00000008020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIIAVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Download sequence
Identical sequences A0A2I3H9C5
XP_003257934.1.23891 ENSNLEP00000007651 ENSNLEP00000007651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]