SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007661 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007661
Domain Number 1 Region: 291-383
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 143-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 3 Region: 210-272
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000706
Family Carboxypeptidase regulatory domain 0.093
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007661
Domain Number - Region: 473-526
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00341
Family Carboxypeptidase regulatory domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007661   Gene: ENSNLEG00000006302   Transcript: ENSNLET00000008030
Sequence length 1155
Comment pep:known_by_projection supercontig:Nleu1.0:GL397382.1:4793802:4801788:1 gene:ENSNLEG00000006302 transcript:ENSNLET00000008030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLPLLCLCVVAAHLAGARDATPTEEPTATALGLERRSVYPGQPSPALEDWEEASEWT
SWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPMALEARTTDWALPSAVGERVHLNPTRG
FWCLNREQPRGRRCSNYHVRFRCPLEASWGAWGPWGPCSGSCGPGRRLRRRHCPSPAGDA
CPGRPLEAQKCVRPRCPGCSLDTCECPDHILLGSVVTPSGQPLPGARLSLRDQPGTVATS
DAHGTFRVPGVCADSRANIRAQMDGFSAGEAQAQANGSISVVTIILDKLEKPYLVKHPES
RVREAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRRAHGYGAHLELRGLRPDQAGIYHCK
AWNEAGAVRSGAARLTVLAPGQPACDPRPREYLIKLPEDCGQPGSGPTYLDVGLCPDTRC
PSLAGSRPRCGDASSRCCSVRRLERREIHCPGYILPVKVVAECGCQKCLPPRGLVRGRVV
AADSREPLRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPF
DPRGAGVYHEVKAMRKKAPVILDASQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYS
GPVEARVTFVDPRDLTSAASAPSDLRFMDSDGELAPLRTYGMFSVDLRAPGSAEQLQVGP
VAVRVAASQIHMPGHVEALKLWSLNPETGLWEEESGFRREGSSGSRVRREERVFLVGNVE
IRERRLFNLDVPERRRCFVKVRAYANDKFTPSEQEGVVVTLVNLEPAPGFSANPRAWGRF
DSAVTGPNGACLPAFCEANRPDAYTALVTANLVGEELEPAPSLPRPLPATVGVTQPYLDR
LGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTSSHFRFAR
VEADRYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGGS
HPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRRV
AVNGLLRDYLARHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRCF
DGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEVAQAQA
RASGPLRTRRGRVRQ
Download sequence
Identical sequences ENSNLEP00000007661 ENSNLEP00000007661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]