SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007665 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007665
Domain Number 1 Region: 34-465
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.28e-78
Family Integrin alpha N-terminal domain 0.000000625
Further Details:      
 
Domain Number 2 Region: 465-622
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-34
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 626-764
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-28
Family Integrin domains 0.0032
Further Details:      
 
Domain Number 4 Region: 772-960
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-27
Family Integrin domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007665   Gene: ENSNLEG00000006295   Transcript: ENSNLET00000008034
Sequence length 1032
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:25381953:25470119:1 gene:ENSNLEG00000006295 transcript:ENSNLET00000008034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPPNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLLYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSRVANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIIKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPMGLYFIKILELEEKQINCEVTDNSGMVQLDCSIGYIYVDH
LSRIDTSFLLDVSSLSRAEEDLTITVHATCENEGEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPKTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMETLKGIVQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVA
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
Download sequence
Identical sequences G1R393
ENSNLEP00000007665 ENSNLEP00000007665 XP_003253848.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]