SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007678 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007678
Domain Number 1 Region: 142-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.7e-125
Family Transglutaminase core 0.00000000000979
Further Details:      
 
Domain Number 2 Region: 3-140
Classification Level Classification E-value
Superfamily E set domains 2.87e-41
Family Transglutaminase N-terminal domain 0.000000489
Further Details:      
 
Domain Number 3 Region: 466-581
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.45e-33
Family Transglutaminase, two C-terminal domains 0.00000046
Further Details:      
 
Domain Number 4 Region: 582-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.49e-27
Family Transglutaminase, two C-terminal domains 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007678   Gene: ENSNLEG00000006304   Transcript: ENSNLET00000008047
Sequence length 683
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:1859459:1893138:-1 gene:ENSNLEG00000006304 transcript:ENSNLET00000008047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRYYASVYSLTFSVVTG
PAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDRTLSLQLTTPANAPIGLYRLSLEATTG
YQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYILTQQGFIYQGSAKFIKNIPWNFGQ
FEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVRKKRWDNN
YGDGISPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSA
HDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEK
SEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINHSLIVGL
KISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMN
MGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSIPL
CILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLV
AEVSLRNPLPVALAGCTFTVEGAGLTEEQKRVEIPDPVESGEEVKVRMDLLPLHMGLHKL
VVNFESDKLKAVKGFRNIIIGPA
Download sequence
Identical sequences ENSNLEP00000007678 ENSNLEP00000007678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]