SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007690 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007690
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily Immunoglobulin 9.3e-28
Family I set domains 0.00013
Further Details:      
 
Domain Number 2 Region: 139-238
Classification Level Classification E-value
Superfamily Immunoglobulin 3.97e-22
Family I set domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007690   Gene: ENSNLEG00000006325   Transcript: ENSNLET00000008059
Sequence length 264
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:37110477:37111774:-1 gene:ENSNLEG00000006325 transcript:ENSNLET00000008059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKPTLWAEPGSVISRG
NPVTIWCQGTLEAQEYRLYKEGSPASWDTQNPLEPRNRANLSIPSMTEHQAGRYRCYYHS
PAGWSEPSDPLELVVTGFYSKPTLSAVPSPVVTSGENVTLQCGSRLRFDRFILTEEGNHK
LSWTLDSQLTPSGQFQALFPVGPVTPSRRWMLRCYGSRRHILQVWSEPSDLLEILISGEE
ATAFSSTIESQTGCGEPYLQGSPC
Download sequence
Identical sequences ENSNLEP00000007690 ENSNLEP00000007690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]