SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007695 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007695
Domain Number 1 Region: 643-831
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-37
Family Fibronectin type III 0.0000577
Further Details:      
 
Domain Number 2 Region: 1053-1145
Classification Level Classification E-value
Superfamily Immunoglobulin 2.85e-25
Family I set domains 0.0073
Further Details:      
 
Domain Number 3 Region: 935-1027
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 559-651
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-19
Family I set domains 0.00097
Further Details:      
 
Domain Number 5 Region: 369-455
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-18
Family I set domains 0.0000123
Further Details:      
 
Domain Number 6 Region: 85-187
Classification Level Classification E-value
Superfamily Immunoglobulin 6.68e-17
Family I set domains 0.00000228
Further Details:      
 
Domain Number 7 Region: 287-369
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000296
Family I set domains 0.00044
Further Details:      
 
Domain Number 8 Region: 460-551
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000558
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 854-943
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000395
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007695   Gene: ENSNLEG00000006235   Transcript: ENSNLET00000008065
Sequence length 1171
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:6478860:6581024:1 gene:ENSNLEG00000006235 transcript:ENSNLET00000008065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPTKKEENEVPAPAPPPEEPSKGKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD
WTLVEPPPGEEQAKQNASSQLSILFVEKPQGGTVKVGEDITFIAKVQAEDLLRKPTIKWF
KGKWMDLASKAGKHLQLKESFERHSRVYTFEMQIIKAKENFAGNYRCEVTYKDKFDSCSF
DLEVRESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK
NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE
LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL
FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG
KKHILIIEGATKADSAEYSVMTTGGQSSAKLTVDLKPLKVLTPLTDQTVNLGKEICLKCE
ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNITLPAK
VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRADKAIMEGSGRIRT
ESYPDSSTLVIDVAERDDSGVYHINLKNEAGEAHASINVKVVDFPDPPVAPTVTEVGDDW
CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF
AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE
YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEV
IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD
TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQTVKIEDVWGENVALTWT
PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL
SEDATMTKESAVIAKDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN
PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK
LEVKVIYQGVNTPGQPVFLEGQQQSLHNKDF
Download sequence
Identical sequences A0A2I3G7Q0
XP_003269962.1.23891 ENSNLEP00000007695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]