SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007700 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007700
Domain Number 1 Region: 321-419
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-28
Family I set domains 0.00045
Further Details:      
 
Domain Number 2 Region: 28-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.76e-24
Family I set domains 0.00027
Further Details:      
 
Domain Number 3 Region: 120-219
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-23
Family I set domains 0.00025
Further Details:      
 
Domain Number 4 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 9.14e-22
Family I set domains 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007700   Gene: ENSNLEG00000006327   Transcript: ENSNLET00000008070
Sequence length 499
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:37136128:37141921:-1 gene:ENSNLEG00000006327 transcript:ENSNLET00000008070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTTLLFFGLSLGPRTQVQAETPLKPSLWAEPGPVITWKKPVTIWCQGPLEAREYRL
DKDGNSMSTHKLKTLESENKIEFSIPSMMWEHAGRYHCYYRSPAGWSEPSHPLELVVTAY
SRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLDSHQHNHGKFQALF
PMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGGNL
TLQCGSDVGYIRYALYKERGDDLPQCPGRQPQAGLSQANFTLGPVRGSHGGQYRCYGAHN
VSSEWSAPSDPLDILIAGQIPDRPSLSVQLGPTVTSGEKVTLLCQSWSPMFTFLLTKEGA
AHPPLRLRSTYRAQQYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELMVSGA
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGLAGLVLVFLGILLFEAQHSQRRPPRCSQE
ANSREDNAPFRVVEPWEQI
Download sequence
Identical sequences G1R3C8
ENSNLEP00000007700 XP_003259814.1.23891 ENSNLEP00000007700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]