SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007781 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007781
Domain Number 1 Region: 65-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.81e-52
Family Astacin 0.00014
Further Details:      
 
Domain Number 2 Region: 424-590
Classification Level Classification E-value
Superfamily TRAF domain-like 5.23e-34
Family MATH domain 0.0016
Further Details:      
 
Domain Number 3 Region: 262-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-29
Family MAM domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007781
Domain Number - Region: 604-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000399
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007781   Gene: ENSNLEG00000006391   Transcript: ENSNLET00000008155
Sequence length 699
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:5097567:5128780:-1 gene:ENSNLEG00000006391 transcript:ENSNLET00000008155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRNLSWFLFLDALLVISGLSESSNVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRN
SIIGEMYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFKGS
GCWSSVGNRQVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILS
GREHNFNTYSDDVSDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMDFS
DSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPENDHSNM
GQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIREY
SADNVDGNLTLVEEIKEIPTGSWQLYHVTLEVTKKFRVVFEGRKGSGASLGGLSIDDINL
SETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLIHVTNAGIYFHLISG
ANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGAV
AFFPNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPTP
SVQDLCSKTTCENDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSSTVA
VFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHAF
Download sequence
Identical sequences ENSNLEP00000007781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]