SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007785 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007785
Domain Number 1 Region: 40-269,368-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.23e-63
Family FAD-linked reductases, N-terminal domain 0.00000000000299
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.28e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000095
Further Details:      
 
Domain Number 3 Region: 516-615
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.32e-28
Family ETF-QO domain-like 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007785   Gene: ENSNLEG00000006389   Transcript: ENSNLET00000008159
Sequence length 617
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:24839966:24876944:1 gene:ENSNLEG00000006389 transcript:ENSNLET00000008159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVPLAKLSCPAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAAAHEKDIRVCLVEKAAQIGAHTLSGACLD
PGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLSS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
Download sequence
Identical sequences G1R3L3
XP_003257954.1.23891 ENSNLEP00000007785 ENSNLEP00000007785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]