SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007790 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007790
Domain Number 1 Region: 62-410
Classification Level Classification E-value
Superfamily Sialidases 1.51e-83
Family Sialidases (neuraminidases) 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007790   Gene: ENSNLEG00000006395   Transcript: ENSNLET00000008164
Sequence length 415
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:8666249:8670993:-1 gene:ENSNLEG00000006395 transcript:ENSNLET00000008164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGERPSTALPGRCWGPRILGFWGGCRIWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSVCAHKAGCQVASTMLVWSKDDGVS
WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Download sequence
Identical sequences G1R3L8
ENSNLEP00000007790 XP_003272176.1.23891 ENSNLEP00000007790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]