SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007796 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007796
Domain Number 1 Region: 26-86
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-18
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007796
Domain Number - Region: 119-154
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00772
Family Rad50 coiled-coil Zn hook 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007796   Gene: ENSNLEG00000006408   Transcript: ENSNLET00000008170
Sequence length 214
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:5251835:5307685:-1 gene:ENSNLEG00000006408 transcript:ENSNLET00000008170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVLSSDSGKSAPASATPRALERRGYPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYENCTECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELEETAARCVCPFCQRELDKDSLLDHYVTHHRSEWRPVFCPLCRLIPDEN
PSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALI
Download sequence
Identical sequences XP_003262007.2.23891 ENSNLEP00000007796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]