SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007809 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007809
Domain Number 1 Region: 65-144
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000314
Family Dual specificity phosphatase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007809   Gene: ENSNLEG00000006420   Transcript: ENSNLET00000008184
Sequence length 210
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:27090117:27121463:1 gene:ENSNLEG00000006420 transcript:ENSNLET00000008184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDL
SSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFSYKSISILDL
PETNILSYFPECFEFIEEAKRKQIKTAIPCPPPQADPMLQVCGSLILRTLFFFFFFFEME
FHSCCPGWGAMTRSQLTATSASQVQVIHLS
Download sequence
Identical sequences ENSNLEP00000007809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]