SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007814 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007814
Domain Number 1 Region: 663-724
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000711
Family VWC domain 0.0043
Further Details:      
 
Domain Number 2 Region: 49-127
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000146
Family VWC domain 0.019
Further Details:      
 
Domain Number 3 Region: 779-842
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family VWC domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007814   Gene: ENSNLEG00000006417   Transcript: ENSNLET00000008189
Sequence length 864
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:38417643:38426485:1 gene:ENSNLEG00000006417 transcript:ENSNLET00000008189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPAPPAPLLLLGLLLLGSWPARGAGPEPPALPIRSEKEPLPVRGAAGCSFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTLACGQPRQLPGH
CCQSCPQERSSSERQPSGLSFEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPR
SQAVARARVSLLRSSLRFSISYRRLDRPTRVRFSDSNGSVLFEHPAAPTQDGLVCGVWRA
VPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGIGGI
TLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFA
EVLPNLTVQEMDWLVLGELQMALERAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ
TGAAGSASLTLLGNGSLIYQAVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVA
ALPYSGHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQG
TVTAHLLGPPGTPGPRRLLKGFYGSEAQGVVKDLEPELLRHLAKGMASLLITTKGSPRGE
LRGQVHIANQCEVGGLRLEAAGAEGVRAPGTPDTASAAPPVVPGLPAPAPAKPGGPGRPR
DPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCP
VCPDSSLQGMPETARCWVFKENTHNFVGLPGLTLSLSLSTVGSGAHPQLGDPMPADGPRG
CRFAGQWFPESQSWHPSVPPFGEMSCITCRCGAGVPHCERDDCSLPLSCGSGKESRCCSR
CMAHQRPAPETRTDPELEKEAEGS
Download sequence
Identical sequences ENSNLEP00000007814 ENSNLEP00000007814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]