SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007856 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007856
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 7.97e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 494-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000562
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000025
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 256-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000169
Family I set domains 0.076
Further Details:      
 
Domain Number 5 Region: 179-247
Classification Level Classification E-value
Superfamily EF-hand 0.000000000154
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007856   Gene: ENSNLEG00000006442   Transcript: ENSNLET00000008231
Sequence length 847
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:27518868:28322062:-1 gene:ENSNLEG00000006442 transcript:ENSNLET00000008231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCWSVVLVLGFIFLELEGRPTKEGGYGLKSYQPLMSLRHKQEKNQESSRVKGFMIQDG
PFGSCENKYCGLGRHCVTNRETRQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACL
KKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLV
DQMFKYFDTDSNGLVDINELTQVIKQEELGKDLFDCTLYDLLKYDDFNADKHLALEEFYR
AFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDF
GDDGSLYITKVTTTHMGNYTCCADGYEQVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPQPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDD
FFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY
YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQY
ITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIK
SLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT
VIWVGDA
Download sequence
Identical sequences G1R3T4
ENSNLEP00000007856 XP_003257962.1.23891 ENSNLEP00000007856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]