SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007871 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007871
Domain Number 1 Region: 146-284
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-25
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 386-498
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000011
Family Cadherin 0.009
Further Details:      
 
Domain Number 3 Region: 264-358
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000542
Family Cadherin 0.00053
Further Details:      
 
Domain Number 4 Region: 81-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000757
Family Cadherin 0.00079
Further Details:      
 
Domain Number 5 Region: 504-592
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000759
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007871   Gene: ENSNLEG00000006455   Transcript: ENSNLET00000008246
Sequence length 1117
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:5779199:5829150:-1 gene:ENSNLEG00000006455 transcript:ENSNLET00000008246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSPGRAYACCFSCAFNVGSGLSLTVLSTRNENKLLPKHPHLVRQKRAWITAPVALREG
EDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
TPFFLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKI
NATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVEA
RDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADEI
GSDNWLANFTIASGNEGNYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVTNKAAFH
KSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISVYVSESMDRSSKGQIIGKFQAFDEDTG
LPAHARYVKLEDRDNWISLDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTI
TGTVLINVEDINDNCPTLMEPVQTICHDAQYVNVTAEDLDGHPNSGPFSFSVIDKPPGMA
EKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQILTLTVCECLHGSGCRE
AQHDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGAKGFTPIPGTIEMLHPWNNEG
APPEDKVVPSFLPVDQGDSLVGRNGVGGMAKEATMKGSSSASIAKGQHEMSEMDARWEEH
RSLLSGRATQVTGATGAIMTTETMKTTRATGASRDMAGAQAAAVALNEEFLRNYFTDKAA
SYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVCL
GQKIDINMEIEQRQKPATETSMNTASHSLYEQTMVNSENTYSSGSSFPVPKSLQEANAEK
VTQEIVTERSVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTVPPTTVILGPRQPQSL
IVTERVYAPASTLVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDAPYIMVRERES
FLAPSSGVQPTLAMPNIAVGQNVTVTERVLAPASTLQSSYQIPTENSMKARNTMVSRAGV
PGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS
Download sequence
Identical sequences ENSNLEP00000007871 ENSNLEP00000007871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]