SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007873 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007873
Domain Number 1 Region: 76-131
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000918
Family Variant RING domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007873   Gene: ENSNLEG00000006467   Transcript: ENSNLET00000008248
Sequence length 289
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:29589123:29948046:-1 gene:ENSNLEG00000006467 transcript:ENSNLET00000008248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWCEAIARNPHRIPNNTRTPEISGDLADASQTSTLNEKSPGRSASRSSNISKASSPTT
GTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDT
RCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRT
AEEIKQGNDNGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWRRLKAYNRVIFVQN
CPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGTNSLPSAEGGPPEVVSV
Download sequence
Identical sequences A0A2J8W060 G1R3V1
XP_003257969.1.23891 XP_018881291.1.27298 ENSNLEP00000007873 ENSGGOP00000012169 ENSNLEP00000007873 ENSGGOP00000012169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]