SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007874 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007874
Domain Number 1 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-18
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 92-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000275
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007874   Gene: ENSNLEG00000006473   Transcript: ENSNLET00000008250
Sequence length 207
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:31047712:31061629:-1 gene:ENSNLEG00000006473 transcript:ENSNLET00000008250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVTALADLRAEASCPICLDYLKDPVTISCGHNFCLSCIIMSWKDLHDSFPCPFCHFCC
PERKFISNPQLGSLTEIAKQLQIRSKKRKRQEEKHVCKKHNQVLTFFCQKDLELLCPRCS
LSTDHQHHCVWPIKKAASYHRKKLEEYNAPWKERVELIEKVITMQTRKSLELKKKTESPV
TRLECGCFSAHFNLRLPGSSDSPASGS
Download sequence
Identical sequences ENSNLEP00000007874 ENSNLEP00000007874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]