SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007878 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007878
Domain Number 1 Region: 145-279
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-25
Family Cadherin 0.00015
Further Details:      
 
Domain Number 2 Region: 260-376
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-17
Family Cadherin 0.00039
Further Details:      
 
Domain Number 3 Region: 76-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000257
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 385-494
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000005
Family Cadherin 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007878
Domain Number - Region: 510-591
Classification Level Classification E-value
Superfamily Cadherin-like 0.0298
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007878   Gene: ENSNLEG00000006471   Transcript: ENSNLET00000008255
Sequence length 999
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:5852654:5884821:-1 gene:ENSNLEG00000006471 transcript:ENSNLET00000008255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGLFPRTTGALAIFMVVILVHGELRIETKGQYEEEEMAMQQAKRRQKREWVKFAKPCRE
GEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREET
PSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILN
ATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGA
DKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDN
WLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVI
SRYRVQSTPVTIQVINVREGIAFRPASKIFTVQKGISSKKLVGYILGTYQAIDEDTNKAA
SNVKYVMGRNDGGYLMIDSKTAEIKFAKNMDRDSTFIVNKTITAEVLAIDEYTGKTSTGT
VYVRVPSFNDNCPTAVLEKDAICSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWS
ITTLNATSALLRAQEQIAPGVYHISLVLTDSQNNRCEIPGSLTLEVCQCDNRDVCGTSYP
TTGPGTRDGRLPSGRLGPAAIGLLLLGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPD
GSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESSEVCTNTYARGTAVEGTSGME
MTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRHSTGGTNKDYT
DGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD
LDDSFLDSLGPKFKKLAEISLGVDGEGKQVQPPSKDSGYGIESCGRLTEVQQPGFVKCQT
LSGSQGASAFSASGSVQPAVSIPDPLQHGNYLVTETYSASGSILQPSTAGFDPLLTQNVI
VTERVICPISSVPGNLAGPTQLRGSHTMLCTEDPCSRLI
Download sequence
Identical sequences G1R3V6
ENSNLEP00000007878 ENSNLEP00000007878 XP_003262014.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]