SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007885 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007885
Domain Number 1 Region: 31-468
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.1e-106
Family Integrin alpha N-terminal domain 0.0000000000000406
Further Details:      
 
Domain Number 2 Region: 469-628
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-46
Family Integrin domains 0.0000000284
Further Details:      
 
Domain Number 3 Region: 769-969
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-41
Family Integrin domains 0.0000000594
Further Details:      
 
Domain Number 4 Region: 629-761
Classification Level Classification E-value
Superfamily Integrin domains 2.2e-36
Family Integrin domains 0.000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007885   Gene: ENSNLEG00000006461   Transcript: ENSNLET00000008262
Sequence length 1020
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:30526389:30616888:1 gene:ENSNLEG00000006461 transcript:ENSNLET00000008262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYEVCMSEPVERGTTKLPLKKKILCNFYISSL
QTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILY
VKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPA
PMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Download sequence
Identical sequences ENSNLEP00000007882 ENSNLEP00000007885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]