SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007902 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007902
Domain Number 1 Region: 145-283
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.00035
Further Details:      
 
Domain Number 2 Region: 262-376
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-16
Family Cadherin 0.00047
Further Details:      
 
Domain Number 3 Region: 384-496
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000131
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 75-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000136
Family Cadherin 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007902
Domain Number - Region: 517-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.000173
Family Cadherin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007902   Gene: ENSNLEG00000006477   Transcript: ENSNLET00000008280
Sequence length 1063
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:5916890:5956350:-1 gene:ENSNLEG00000006477 transcript:ENSNLET00000008280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWLFFRNIYLLIILMVVMEVNSEFIVEVKEFDIENGTAKWQTVRRQKREWIKFAAACRE
GEDNSKRNPIAKIRSDCESNQKITYRISGVGIDRPPYGVFTINPRTGEINITSVVDREIT
PLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQSVYTASIEENSDANALVVKLC
ATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEVRTMSSFLDREQHSMYNLVVRGS
DRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSASIEENCLSSELIRLQAIDLDEEGT
DNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVVKMLDYEQAPNIQLSIGVKNQADFHYS
VASQFRMHPTPVRIQVVNVREGLAFHPSTMAFSVREGIKGSSLLNYVLGTYTAIDLDTGN
PATDVRYIIGHDAGSWLKIDSRTGEIQLSREFDKKSKYIINGIYTAEILAIDDGSGKTAT
GTICIEVPDIHDYCPNIFPERRTICIDSPSILISVNEHSYGSPFTFCVVDEPPGTADMWD
VRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGA
AGIYTEDITGDTYGPVTEDQAGVSNVGLGPAGIGMMVLGILLLLLSPLLLLLCCCKQRQP
EGLGTRFAPVPEGGEGVMQSWRIEGAHPEDRLFSAYALPGGGGTADGGGDSVLGRCALQA
TRALLHQHPPFSEIYTNTYAAGGTVEGGVSGVELNTGMGTAVGLVAAGAAGAAGAAGAAR
KRSSTMGTLRDYADSDINMAFLDSYFSEKAYAYADEDEGRPANDCLLIYDHEGVGSPVGS
IGCCSWIVDDLDESCMETLDPKFRTLAEICLNTEIEPFPSHQACIPISTDLPLLGPNYFV
NESSGLTPSEVEFQEEMAASEPVVHGDIIVTETYGNADQGVQPTTIIFDPQLAPNVVVTE
AVMAPVYDIQGNICVPAELADYNNVIYAERVLASPGVPDMSNSSMTDGCMGPVMSGNILV
GPEIQVMQMMSPDLPISQTVGSTSPMTSRHRVTRYSNIHYTQQ
Download sequence
Identical sequences G1R3Y0
ENSNLEP00000007902 XP_003262016.1.23891 ENSNLEP00000007902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]