SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007907 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007907
Domain Number 1 Region: 145-283
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-25
Family Cadherin 0.00028
Further Details:      
 
Domain Number 2 Region: 262-356
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 75-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000257
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 382-469
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000799
Family Cadherin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007907   Gene: ENSNLEG00000006497   Transcript: ENSNLET00000008286
Sequence length 1047
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:5974527:6006436:-1 gene:ENSNLEG00000006497 transcript:ENSNLET00000008286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWSFFRVAAVLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVT
PFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILN
ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYSLAVRGS
DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTVEIQENTLNSNLLEIRVIDLDEEFS
ANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHS
IMSQYKLTASAISVTVSNVIEGPVFRPGSKTYVVTGNMGANDKVGEFVATDLDTGRPSTT
VRYVMGNNPADLLAVDSRTGKLTLKNKVTREQYNMLGGKYQGTILSIDDTLQRTCTGTIN
IDIQGFDGDDRTNTEPSTEITTNTGRQESSSSTDYETSTTSAVSQYIVSYGPANESPLSD
NVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGASRGAAGFEPVPECSDGAIHSWAVEGP
QPEPRDMTTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGVKT
SGMPEICQEYSGTLRRNSMRECREGGLNMNFMENYFCQKAYAYADEDEGRPSNDCLLIYD
IEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPDLDPSWPPQSTEP
VCLPQETEPIVSGHLPISPHFGTTTVISESTYPSGPGIQHPKPILDPLGYGNVTVTESYT
TSDTLKPSVHVHDNRPASNVVVTERVVGPISGTDLHGMLEMPDLRDGSNVIVTERVIAPS
SSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAGVT
GISGTTGISGGIGSSGLVGTSMGAGGGALSGAGVSGGGIGLSSLGGTATIGHMRSSSDHH
FNQTIGSASPSAARSRITKYSTVQYSK
Download sequence
Identical sequences ENSNLEP00000007907 ENSNLEP00000007907 XP_003262017.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]