SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007922 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007922
Domain Number 1 Region: 230-366
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-30
Family Cadherin 0.00017
Further Details:      
 
Domain Number 2 Region: 460-584
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 348-466
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-17
Family Cadherin 0.00024
Further Details:      
 
Domain Number 4 Region: 31-154
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000487
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 140-242
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000857
Family Cadherin 0.00072
Further Details:      
 
Domain Number 6 Region: 571-667
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000116
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007922   Gene: ENSNLEG00000006503   Transcript: ENSNLET00000008304
Sequence length 894
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:6149427:6182730:1 gene:ENSNLEG00000006503 transcript:ENSNLET00000008304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVASAAPGSIFCKQLLFSLLVLILLCDACQKIYLRVPSHLQAETLVGKVNLEECLKSAS
LIRSSDPAFRILEDGSIYTTHDLILSSERKSFSIFLSDGQRQEQQEIEVVLLARENKAPK
KRHTKDTALKRSKRRWAPIPASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDKE
PFNLFYIEKDTGDIFCTRSIDREKYEQFALYGYATTADGYAPEYPLPLIIKIEDDNDNAP
YFEHRVTIFTVPENCRTGTSVGKVTATDLDEPDTLHTRLKYKILQQIPDHPKHFSIHPDT
GVITTTTPFLDREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDNPPSFTETSYV
TEVEENRIDVEILRMKVQDQDLPNTPHSKAVYKILQGNENGNFKISTDPNTNEGVLCVVK
PLNYEVNRQVILQVGVVNEAQFSKAANSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQS
QDGFPAGQELLGYKALDPETSSGEGLRYQKLEDEDNWFEINQHTGDLRTLKVLDRESKFV
KNNQYNISVVAVDAVGRSCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLEPVDPDG
PENGPPFQFFLDNSTSKNWNLEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHVL
TVRVCDCSTPSECRMKGKSTRDVRPNVILGRWAILAMVLGSVLLLCILFTCFCVTAKRTV
KKCFPEDIAQQNLIVSNTEGPGEEVTEANIRLPMQTSNICDTSMSVGTVGGQGIKTQQSF
EMVKGGYTLDSNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEH
KHCEDYVRSYNYEGKGSLAGSVGCCSDRQEEEGLEFLDHLEPKFRTLAKTCVKK
Download sequence
Identical sequences G1R400
XP_003262019.1.23891 ENSNLEP00000007922 ENSNLEP00000007922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]