SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007929 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007929
Domain Number 1 Region: 489-797
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000103
Further Details:      
 
Domain Number 2 Region: 760-1057
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.71e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000182
Further Details:      
 
Domain Number 3 Region: 6-201
Classification Level Classification E-value
Superfamily Fibronectin type III 3.4e-28
Family Fibronectin type III 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007929   Gene: ENSNLEG00000006520   Transcript: ENSNLET00000008311
Sequence length 1058
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:5816166:6217991:-1 gene:ENSNLEG00000006520 transcript:ENSNLET00000008311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPVHGPQNVEIVDIRARQLTLQWEPFGYTVTRCHSYNLTVQYQYVFNQQQYEAEEVIQT
SSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEEKIY
IQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGTTYS
FTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPLNETDTTITVMLKPAQSRGAPVSV
YQLVVKEERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGD
NKTYNGYWNPPLSPLKSYSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDN
TVKMAGVIAGLLMFIIILLGVMLTIKRRRNAYSYSYYLKLAKKQKETQSGAQREMGPVAS
ADKPTTKLSANRNDEGFSSSSQDVNGFTDGSRGELSQPTLTIQTHPYRTCDPVEMSYPRD
QFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIIS
YDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASI
VMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELR
LFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDM
TENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNI
SRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLIS
VDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVMLNEMDTAQF
CMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAY
RDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQQNI
IDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF
Download sequence
Identical sequences ENSNLEP00000007929 ENSNLEP00000007929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]