SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007934 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007934
Domain Number 1 Region: 244-381
Classification Level Classification E-value
Superfamily Cadherin-like 1.19e-28
Family Cadherin 0.00035
Further Details:      
 
Domain Number 2 Region: 361-477
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-18
Family Cadherin 0.00022
Further Details:      
 
Domain Number 3 Region: 473-577
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-16
Family Cadherin 0.0031
Further Details:      
 
Domain Number 4 Region: 32-168
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000706
Family Cadherin 0.0022
Further Details:      
 
Domain Number 5 Region: 155-256
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000228
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 610-678
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000318
Family Cadherin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007934   Gene: ENSNLEG00000026724   Transcript: ENSNLET00000008317
Sequence length 908
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:6209573:6255493:1 gene:ENSNLEG00000026724 transcript:ENSNLET00000008317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSGSCSGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTA
ANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKIS
LLVPWLCLVAVVLKKRHAKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNY
TIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPL
PLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQ
VPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIININD
VNDHLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIV
TDAKTNEGVLCVVKPLNYEEKQQVILQIGVVNEAPFSGEASSRSAMSTATVTVNVKDQDE
GPECNPPIQTVRMKENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTVDENTGSI
KVFRSLDREAETIKNGIYNITVLASDQGKNLSLSSYILPWLHTSSVFKPTVYILKLGKCT
LKVYYNLLTHPIHGPPFDFSLESSEVQRMWRLKEINDTAARLSYQNDPPFGSYIVPVTVR
DRLGMSSVTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFT
LVCGASGTSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVG
SRVKNGGQETIEMVKGGHQTSESCRGTGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPR
LGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRT
LAEACMKR
Download sequence
Identical sequences ENSNLEP00000007934 ENSNLEP00000007934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]