SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007944 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007944
Domain Number 1 Region: 209-329
Classification Level Classification E-value
Superfamily EF-hand 9.86e-37
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 298-391
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.42e-29
Family Thyroglobulin type-1 domain 0.00074
Further Details:      
 
Domain Number 3 Region: 138-192
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000291
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007944
Domain Number - Region: 404-441
Classification Level Classification E-value
Superfamily ARM repeat 0.0719
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007944   Gene: ENSNLEG00000006528   Transcript: ENSNLET00000008327
Sequence length 444
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:32846158:33345014:-1 gene:ENSNLEG00000006528 transcript:ENSNLET00000008327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPHPPLCLLSQMLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTI
SQYDKEVGQWNKFRDDDYFRTWSPGKPFNQALDPAKDPCLKMKCSRHKVCIAQDSQTAVC
ISHRRLTHRMKEAGVDHRQWRGPILSSCKQCPMVYPSPVCGSDGHTYSFQCKLEYQACVL
GKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTK
TLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNS
CDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQ
CHGSVGQCWCVDRYGNEVMGSRKNGVADCAIDFEISGDFASGDFHEWTDDEDDDDIMNDE
DEIEDDDEDEGDDDDGGDDHDGYI
Download sequence
Identical sequences XP_003257985.1.23891 ENSNLEP00000007944 ENSNLEP00000007944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]