SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007945 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007945
Domain Number 1 Region: 170-309
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-31
Family Cadherin 0.00000191
Further Details:      
 
Domain Number 2 Region: 401-525
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-26
Family Cadherin 0.00053
Further Details:      
 
Domain Number 3 Region: 291-410
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-20
Family Cadherin 0.00011
Further Details:      
 
Domain Number 4 Region: 80-174
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-16
Family Cadherin 0.00000303
Further Details:      
 
Domain Number 5 Region: 514-621
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000414
Family Cadherin 0.0029
Further Details:      
 
Domain Number 6 Region: 2-93
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000298
Family Cadherin 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007945   Gene: ENSNLEG00000006531   Transcript: ENSNLET00000008328
Sequence length 821
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:9211781:9419881:1 gene:ENSNLEG00000006531 transcript:ENSNLET00000008328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPALTEESVKESAEVEEIVFPR
QFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQP
PTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRP
EFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINN
ETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAM
TFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVT
VVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIR
QEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPN
VKNNVYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITA
LDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDS
GNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVW
MKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVG
IRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGS
TAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Download sequence
Identical sequences ENSNLEP00000007945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]