SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007953 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007953
Domain Number 1 Region: 40-82,321-465
Classification Level Classification E-value
Superfamily Fibronectin type III 6.62e-24
Family Fibronectin type III 0.00000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007953   Gene: ENSNLEG00000006539   Transcript: ENSNLET00000008336
Sequence length 476
Comment pep:novel supercontig:Nleu1.0:GL397326.1:9034723:9058604:1 gene:ENSNLEG00000006539 transcript:ENSNLET00000008336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSWHCAVWHSMYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVK
WDEVSTVEGYLLQLSTDLPYQAASPDSSAALNMQGVRMDPHRQGGNNIVPNSISDTINST
KTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPHTSANVG
VLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAVVKDETSLTTFSTKSEV
DETYALPATKISRVETHATATPFSKETPSNPVATVKAGERQWCDVGIFKNNTALVSQFYL
LPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCGIGPFSKISEFKTCIPG
FPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQIQDNPSQLVFMRIYCG
LKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRWLQGNNKKAPLN
Download sequence
Identical sequences ENSNLEP00000007953 ENSNLEP00000007953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]