SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007969 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007969
Domain Number 1 Region: 19-279
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-54
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 677-879
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-46
Family YWTD domain 0.0000182
Further Details:      
 
Domain Number 3 Region: 330-538
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-45
Family YWTD domain 0.00000389
Further Details:      
 
Domain Number 4 Region: 926-1128
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-28
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 5 Region: 1316-1352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1278-1314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1238-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 882-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.02
Further Details:      
 
Domain Number 9 Region: 583-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.009
Further Details:      
 
Domain Number 10 Region: 285-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000661
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1195-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000512
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007969   Gene: ENSNLEG00000006550   Transcript: ENSNLET00000008352
Sequence length 1596
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:6958594:7108771:1 gene:ENSNLEG00000006550 transcript:ENSNLET00000008352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFLCEIHASVPSKAASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAAAVDFQFSK
GAVYWTDVSEEAIKQTYLNQTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEV
ANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDI
YWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTD
WQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSP
REPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRH
AIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTD
TGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQER
RVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGLANP
AMRLDPTRGSAPLSCVAHGGIHCVVWPHPFPYWAVDPLCSLPGTNPCADRNGGCSHLCFF
TPRATRCGCPIGLELLSDKKTCIVPEAFLAGESLEPGGRGCSEPRSHHCTPGWARRAKLR
LKKKKKMALFLLTCCQTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNR
IEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVD
KVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWT
DWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIP
GGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKA
IDYDPLDKFIYWVDGRQNIKRAKDDGTQARPFVLTSLSQGQNPDRQPHDLSIDIYSRTLF
WTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALD
GTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGTSRLGGPPASASQSAG
ITGVSHRAWHQARDQTVGRAAKAGGSRGQEIKTILANMVGGRADLHLSCFVFAAAHPCAR
DNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWR
CDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPN
QFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFV
MGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTAPFCFLWGLA
SEPHLAGAEGVPLLDEGGRKECPGRRGSRSPWLGSPQILNPPPSPATDPSLYNMDMFYSS
NIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTP
HSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSNLEP00000007969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]