SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007992 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007992
Domain Number 1 Region: 32-218
Classification Level Classification E-value
Superfamily vWA-like 7.19e-51
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 1029-1234
Classification Level Classification E-value
Superfamily vWA-like 3.77e-25
Family Integrin A (or I) domain 0.0083
Further Details:      
 
Domain Number 3 Region: 596-773
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-23
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 4 Region: 233-409
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-21
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 779-951
Classification Level Classification E-value
Superfamily Fibronectin type III 4.5e-20
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 6 Region: 421-586
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-17
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 2871-2930
Classification Level Classification E-value
Superfamily BPTI-like 1.35e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 8 Region: 957-1043
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000691
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007992   Gene: ENSNLEG00000006514   Transcript: ENSNLET00000008376
Sequence length 2943
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:36796820:36827963:-1 gene:ENSNLEG00000006514 transcript:ENSNLET00000008376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRLLVAVLFAGILAGAPRVRAQHRERVTCTRLYAADIVFLLDGSSSIGRSNFREVRSF
LEGLVLPFSGAVSAQGVRFATVQYSDDPRTEFGLDALGSGGDVIRAIRELSYKGGNTRTG
AAILHVADRVFLPQLARPGIPKVCILITDGKSQDLVDTAAQRLKGQGVKLFAVGIKNADP
EELKRVASQPTSDFFFFVNDFSILRTLLPLVSRRVCTTAGGVPVTRPPDDSTSAPRDLVL
SEPSSQSLRVQWTAASGPVTGYKVQYTPLTGLGQPLPSERQEVNVPAGETSVRLQGLRPL
TEYQVTVVALYANSIGEAVSGTARTTALEGPELTIQNTTAHSLLVAWRSVPGATGYRVTW
RVLSDGPTQQQELGPGQGSVLLHDLEPGTDYEVTVSTLFGRSVGPATSLTARTDASVEQT
LRPVILGPTSILLSWNLVPEARGYRLEGRETGLEPPQKVVLPSDVTRYQLDGLQPGTEYR
LTLYTLLEGREVATPATVVPTGPELPVSPVKDLQATELPGQRVRVSWSPVPGATQYRIIV
RSTQGVERTLVLPGSQTAFDLDDVQAGLSYTVRVSARVGPREGSASVLTVRREPETPLAV
PGLRVVVSDATRVRVAWGPVPGASGFRISWSTGSGPESSQTLPPDSTATDITGLQPGTTY
QVAVSVLQGREEGPAVVIVARTDPLGPVRTVHVTQAGSSSVTITWTRVPGATGYRVSWHS
AHGPEKSQLVSGEATVAELDGLEPDTEYTVHVRAHVAGVDGPPASVVVRTAPEPVGRVSR
LQILNASSDVLRITWVGVTGATAYRLAWGRSEGGPMRHQILPGNTDSAEIRGLEGGVSYS
VRVTALVGDREGTPVSIVVTTPPEAPPALGTLHVVQRGEHSLRLRWEPVPRAQGFLLHWQ
PEGGQEQSRVLGPELSSYHLDGLEPATQYRVRLSVLGPAGEGPSAEVTARTESPRVPSTE
LRVVDTSIDSVTLAWTPVSRASSYILSWRPLRGPGQEVPGSPQTLPGISSSQRVTGLEPG
ISYIFSLTPVLDGVRGPEASVTQTPVCPRGLADVVFLPHATQDNAHRAEATRRVLERLVS
ALGPLGPQAVQVGLLSYSHRPSPLFPLNGSHDLGIILQRIRDMPYMDPSGNNLGTAVVTA
HRYVLAPDAPGRRQHVPGVMVLLVDEPLRGDIFSPIREAQAAGLNVVMLGMAGADPEQLR
RLAPGMDSVQTFFAVDDGPSLDRAVSGLAAALCQASFTTQPRPEPCPVYCPKGQKGEPGE
MGLRGQVGPPGDPGLPGRTGAPGPQGPPGSAIAKGERGFPGADGRPGSPGRPGNPGTPGA
PGLKGSPGLPGPRGDPGEQGPRGPKGEPGAPGQIIGGEGPGLPGRKGDPGPSGPPGPHGP
LGDPGPRGPPGLPGTAVKGDKGDRGERGPPGPGEGGIAPGEPGLPGLPGSPGPQGPAGPP
GKKGEKGDSEDGSPGLPGQPGSPGEQGPRGPPGAIGPKGDRGFPGPLGEAGEKGERGPPG
PAGSRGLPGVAGRPGAEGPEGPPGPAGRQGEKGEPGRPGDPAVVGPAVAGPKGEKGDVGP
AGPRGATGVQGERGPPGLVLPGDPGPKGDPGDRGPIGLTGRAGPPGDSGPPGEKGDPGRP
GSPGPVGPRGREGEVGEKGDEGPPGDPGLPGKAGERGLRGAPGVRGPVGEKGNQGDPGED
GRNGSPGPSGPKGDRGEPGPPGPPGRLVDTGPGAREKGEPGDRGQEGPRGPKGDPGLPGA
PGERGIDGLRGPPGPQGDPGVRGPAGEKGDRGPPGLDGRSGLDGKPGAPGPSGPNGAAGK
AGDPGRDGLPGLRGEQGPPGPSGPPGLPGKPGEDGKPGLNGKNGEPGDPGEDGRKGEKGD
SGAPGREGRDGPKGEHGAPGILGPQGPPGLPGPVGPPGQGFPGVPGGAGPKGDRGETGSK
GEQGLPGERGLRGEPGSMPNVDRLLETAGIKASALREIVETWDESSGSFLPVPERRRGPK
GDSGERGPPGKEGPIGFPGERGLKGDRGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGI
PGLPGRAGGVGEEGRPGERGERGEKGERGEQGRDGPPGLPGTPGPPGPPGPKVSVDEPGP
GLSGEQGPPGLKGAKGEPGSDGDRGPKGDRGVPGIKGDRGEPGPRGQDGNPGLPGERGVA
GPEGKPGLQGPRGPPGPVGGHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGRGLPG
PTGAVGLPGPPGPSGLVGPQGSPGLPGQVGETGKPGAPGRDGASGKDGDRGSPGVPGSPG
LPGPVGPKGEPGPTGAPGQAVVGLPGAKGEKGAPGGLAGDLVGEPGAKGDRGLPGPRGEK
GEAGRAGEPGDPGEDGQKGAPGPKGFKGDPGVGVPGSPGPPGPPGVKGDLGLPGAPGAPG
VVGFPGQTGPRGEMGQPGPSGERGLAGPPGREGVPGPLGPPGPPGSVGPPGASGLKGDKG
DSGAGLPGPRGERGEPGVRGEDGRPGQEGPRGLTGPPGSRGERGEKGDVGTAGLKGDKGD
SAVILGPPGPRGAKGDMGERGPRGLDGDKGPRGDNGDPGDKGSKGEAGDKGSAGSPGLRG
LPGPQGQPGAAGIPGDPGSPGKDGVPGIRGEKGDVGFMGPRGLKGERGVKGACGLDGEKG
DKGEAGPPGRPGLAGHKGEMGEPGVPGQSGAPGKEGLIGPKGDRGFDGQPGPKGDQGEKG
ERGTPGIGGFPGPSGNDGSAGPPGPPGSVGPRGPEGLQGQKGERGPPGERVVGAPGAPGA
PGERGEQGRPGPAGPRGEKGEAALTEDDIRGFVRQEMSQHCACQGQFIASGSRPLPRYAA
DTAGSQLHAVPVLRVSHAEEEERVPPEDDEYSEYSEYSVEEYQDPEAPWDSDDPCSLPLD
EGSCTAYTLRWYHRAVTGGTEACHPFVYGGCGGNANRFGTREACERRCPPRVAQSRGTGT
AQD
Download sequence
Identical sequences ENSNLEP00000007992 ENSNLEP00000007992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]