SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008015 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008015
Domain Number 1 Region: 271-364
Classification Level Classification E-value
Superfamily Immunoglobulin 7.24e-26
Family I set domains 0.0052
Further Details:      
 
Domain Number 2 Region: 438-539
Classification Level Classification E-value
Superfamily Immunoglobulin 7.14e-25
Family I set domains 0.0036
Further Details:      
 
Domain Number 3 Region: 1133-1226
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-23
Family I set domains 0.0089
Further Details:      
 
Domain Number 4 Region: 1231-1326
Classification Level Classification E-value
Superfamily Immunoglobulin 6.22e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 1001-1095
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-21
Family I set domains 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008015
Domain Number - Region: 800-805
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00149
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008015   Gene: ENSNLEG00000006567   Transcript: ENSNLET00000008400
Sequence length 1383
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:34600343:35052332:1 gene:ENSNLEG00000006567 transcript:ENSNLET00000008400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADPETEDFDS
EKEISQIFNTSPASLCEHPSHKETKLGEHTSKRPQDNRSTPVQPLAEEQTKNISSLVSKR
KPAMSPLLTRPSYIRSLRKAEKRGAKTPSTNVKPKMPHQGKAGPQSQLCDKAANLIEELT
SIFKAAKPRNRSSNGESSSPDSGYLSPKNQPSALLSASASQSPTEDQGEMEREVKSPGAR
HCYQNNQDLAVPHNPKSHPQPHGAHHFPAAPRFIQKLRSQEVAEGSRVYLECRVTGDPTP
RVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPSGSDTTSAEVF
IEGASSTDSDSESLAFKSKAGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQ
VHSPTSYLCRPDGTTTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLRVQWFRQGSE
IQDSPDFRILQKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVTS
ANTENCSYKSVGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQ
MQFNAAERETNGVHPSHGVNGLINGKAKSNKSLPTPAVLLSPTKEPPPLLAKPKLGPSEI
QQLQNQIRLEQLAGARQPPPAPRSAPPSPPFPPPPAFPELAACTPPASPEPMSALASRSA
PAMQSSGSFNYARPKQFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPRQFGRAPVPPF
AQPFGTEPDAPWGSSSPSPPPPPPPVFSPTAAFPVPDVFPLPPPPPPLPSPGQASHCSSP
ATRFGHSQTPAAFLSALLPSQPPPAAVNALGLPKGVTPAGFPKKASRTARIASDEEIQGT
KDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYK
VSSCEQRLISEIEYRLERSPVDESGDEVQYGDVSVENGTAPFFEMKLKHYKIFEGMPVTF
TCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANP
QGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQA
PGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTS
RDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGV
PPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCT
ARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVES
EDL
Download sequence
Identical sequences ENSNLEP00000008015 ENSNLEP00000008015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]