SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008029 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008029
Domain Number 1 Region: 24-80
Classification Level Classification E-value
Superfamily RING/U-box 1.73e-16
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008029   Gene: ENSNLEG00000006598   Transcript: ENSNLET00000008414
Sequence length 180
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:8953194:8955105:1 gene:ENSNLEG00000006598 transcript:ENSNLET00000008414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Download sequence
Identical sequences A0A024RCQ4 A0A2I3H4E1 A0A2K5J6J0 A0A2K6LL20 A0A2K6QN74 G3RQU7 H2R7G2 Q99942
gi|5902054|ref|NP_008844.1| ENSP00000364235 ENSP00000387879 ENSP00000388795 ENSP00000401172 ENSP00000413131 ENSP00000415127 ENSP00000415784 ENSPTRP00000050329 hss001001272.1 NP_008844.1.87134 NP_008844.1.92137 XP_001164301.1.37143 XP_003272190.1.23891 XP_003829821.1.60992 XP_004043802.1.27298 XP_004695222.1.23501 XP_010376417.1.97406 XP_011788769.1.43180 XP_011800178.1.43180 XP_017714665.1.44346 ENSNLEP00000008029 ENSP00000364235 ENSP00000387879 ENSP00000388795 ENSP00000401172 ENSP00000413131 ENSP00000415127 ENSP00000415784 9598.ENSPTRP00000030755 9606.ENSP00000364235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]