SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008061 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008061
Domain Number 1 Region: 393-589
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-38
Family Fibronectin type III 0.00051
Further Details:      
 
Domain Number 2 Region: 696-889
Classification Level Classification E-value
Superfamily Fibronectin type III 6.82e-38
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 296-389
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-22
Family I set domains 0.0046
Further Details:      
 
Domain Number 4 Region: 211-309
Classification Level Classification E-value
Superfamily Immunoglobulin 3.83e-19
Family I set domains 0.027
Further Details:      
 
Domain Number 5 Region: 16-105
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 113-201
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 591-672
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000415
Family Fibronectin type III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008061   Gene: ENSNLEG00000006624   Transcript: ENSNLET00000008447
Sequence length 1125
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:16872241:17038350:-1 gene:ENSNLEG00000006624 transcript:ENSNLET00000008447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLSPIPGAWCFSELSFVQEPQDVTVTRKDPVVLDCQAHGEVPIKVTWLKNGAKVSENKR
IEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMNKYGAILSQKAHLALSTISAFEVQPIST
EVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMDRITALPTGVLQIYDVSQRDSGNYR
CVAATVTHRRKSMEASLTVIPAKESKSFHTPIIIAGPQNITTSLHQTVVLECMATGNPKP
IISWSRLDHKSIDVFNTRVLGNGNLMISDVRLQHAGVYVCRATTPGTRNFTVAMATLTVL
APPSFVEWPESLTRPRAGTARFMCQAEGIPSPKMSWLKNGRKIHSNGRIKMYNSKLVINQ
IIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPSAPYNVHAETMSSSAILLAWERPLY
NSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDDLEPASNYTFYIVAYMPMGASQM
SDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPIPAKYRRGQVVLYRLSFRLSTENSI
QVLELPGTTHEYLLEGLKPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKAPKSPEL
HLEPLNCTTISVRWQQDVEDTAAIQGYKLYYKEEGQQENGPIFLDAKDLLYTLSGLDPRR
KYHVRLLAYNIEDGYQADQTVSTPGCVSVRDRMVPPPPPPHHLYAKANTSSSIFLHWRRP
AFTAAQIINYTIRCNPVGLQNASLVLYLQTSETQMLVQGLEPNTKYEFAVRLHVDQLSSP
WSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSWKPPDGPETVVTRYTILYASRKAWIA
GEWQVLHREGAITMALLENLVAGNVYIVKISASNEVGEGPFSNSVELAVLPKETSESNQR
PKRLDSADAKVYSGYYHLDQKSMTGIAVGVGIALTCILICVLILIYRSKARKSSASKTAQ
NGTQQLPRTSASLASGNEVGKNLEGAVGNEESLMPMIMPNSFIDAKGGTDLIINSYGPII
KNNSKKKWFFFQDSKKIQVEQPQRRFTPAVCFYQPGTTVLISDEDSPSSPGQTASFSRPF
GVAADTEHSANSEGSHETGDSGRFSHESNDEIHLSSVISTTPPNL
Download sequence
Identical sequences ENSNLEP00000008061 ENSNLEP00000008061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]