SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008073 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008073
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.0026
Further Details:      
 
Domain Number 2 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000146
Family VWC domain 0.046
Further Details:      
 
Domain Number 3 Region: 192-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000536
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008073   Gene: ENSNLEG00000006637   Transcript: ENSNLET00000008459
Sequence length 250
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:8499899:8518137:1 gene:ENSNLEG00000006637 transcript:ENSNLET00000008459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTPKTHLLAFSLLCLLSKVCTQLCPTPCTCPWPPTRCPLGVPLVLDGCGCCRVCARRL
GEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDGSCEVNGRLYREGETFQPHCSIR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCGQGGGLGAQPLPAQGPQ
FSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPS
RGRSPQNSAF
Download sequence
Identical sequences G1R4F1
ENSNLEP00000008073 XP_003253659.1.23891 XP_012367280.1.23891 ENSNLEP00000008073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]