SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008081 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008081
Domain Number 1 Region: 47-142
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-18
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008081   Gene: ENSNLEG00000006644   Transcript: ENSNLET00000008467
Sequence length 409
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:36087839:36107380:-1 gene:ENSNLEG00000006644 transcript:ENSNLET00000008467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKE
GNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDR
GKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYYMVVCLVAFTIVMVLNITRLCMMSSHLK
KTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARS
VPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEAAHRDEVYTIPNSLKRSDSPA
ADSDASSLHEQPQQIAIKVSVHPQSKKEHADDQEGGQFEVKDVEETELSAEHSPETAEPS
TDVTSTELTSEEPTPVEVPDKALTPAYLEATEPAVTHDKNTCIIYESHV
Download sequence
Identical sequences G1R4F9
XP_003258012.1.23891 ENSNLEP00000008083 ENSNLEP00000008081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]