SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008096 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008096
Domain Number 1 Region: 943-1312
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.01e-127
Family Hect, E3 ligase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 888-927
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000682
Family WW domain 0.00013
Further Details:      
 
Domain Number 3 Region: 601-644
Classification Level Classification E-value
Superfamily WW domain 0.000000000000362
Family WW domain 0.0011
Further Details:      
 
Domain Number 4 Region: 761-801
Classification Level Classification E-value
Superfamily WW domain 0.000000000000821
Family WW domain 0.0018
Further Details:      
 
Domain Number 5 Region: 840-874
Classification Level Classification E-value
Superfamily WW domain 0.00000000000393
Family WW domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008096
Domain Number - Region: 513-576
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000467
Family PLC-like (P variant) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008096   Gene: ENSNLEG00000006630   Transcript: ENSNLET00000008483
Sequence length 1319
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:17082228:17174101:-1 gene:ENSNLEG00000006630 transcript:ENSNLET00000008483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHVCFKRPTRISTSNVVQMKLTPRQTALAP
LIKENVQSQERSSVPSSENVNKKSSCLQISLQPTRYSAYLQSSNVLADSDDASFTCILKD
GIYSSAVVDNELNAVNDGNLVSNPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGS
YTNSVVSDSSSYTFPPSDDTVLSGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDD
LEHGLEIMKLPVSRNTKIPLKRCSSLVIFPRSPSNTPPTSPTSPCTLLSKGSYQTSHQFI
ISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNT
PRQTVCEKSSEGYSCASVHFTQQKATTLDCETTNGDCKPEMSEIKLNSDSEYIKLTHRTS
ACLPSSQNVDYQININGELERPHSQMNKNHGILQRSISLGGAYPNISCLSSLKHNCSKGG
PSQLLIKFASGNESKVDNLSRDSNRDYTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLE
RPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAA
CHLQQRQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQ
RAFTTRRQISEETESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPTHLAEEL
NARLTIFGNSAMSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDER
GRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQAFTSDSGQQVTQPSEIERG
FLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPVHLRGKTSLDTSNDLGPLPPGWEE
RTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPN
KFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMF
NPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFY
KMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSE
IVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG
DVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAEL
YGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences G1R4H4
ENSNLEP00000008096 XP_003267006.1.23891 ENSNLEP00000008096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]