SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008104 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008104
Domain Number 1 Region: 1570-1812
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.23e-54
Family Ankyrin repeat 0.000000953
Further Details:      
 
Domain Number 2 Region: 473-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000957
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 926-1045
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 272-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000111
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 583-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 762-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000177
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 7 Region: 352-475
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 189-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 153-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000129
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 686-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000438
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1041-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000547
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 231-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.025
Further Details:      
 
Domain Number 13 Region: 804-928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 309-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000398
Family EGF-type module 0.009
Further Details:      
 
Domain Number 15 Region: 723-763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 26-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000477
Family EGF-type module 0.025
Further Details:      
 
Domain Number 17 Region: 61-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000621
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 1210-1240
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 19 Region: 1247-1277
Classification Level Classification E-value
Superfamily Notch domain 0.0000392
Family Notch domain 0.0032
Further Details:      
 
Domain Number 20 Region: 116-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.043
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008104
Domain Number - Region: 1169-1198
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1083-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1128-1166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00583
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 620-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0141
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008104   Gene: ENSNLEG00000006638   Transcript: ENSNLET00000008491
Sequence length 1994
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:8974638:9005344:-1 gene:ENSNLEG00000006638 transcript:ENSNLET00000008491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLCVSVVITRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGETCQFP
DPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEGPCPPS
FCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCHCPSG
FEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGREGPRCELRAGPCPPRGCSN
GGTCQLMPGKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPET
WTGWDCSEDVDECETQGAPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCA
PGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYS
GPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCH
PGTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFAGT
RCEEDINECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLD
LPRAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCT
CQHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQASGYNCTCPTGYTGPTC
SEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGTQCQTSTDYCVSAPCFNGGTCVNRP
GTFSCLCAMGFQGPRCEGKIRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMD
LCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDISSLCHNGGL
CVDSGPSYFCRCPPGFQGSLCQDPVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCS
KELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSL
ANAFYCQCLPGYTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSH
RAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSC
SETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLG
VPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNG
HCEKGCNTAECGWDGDCSLRWDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLRVGLW
VRKDRDGRDMVYPYPGARAEEKLGGTRDPSYQERAPPQTQPLGETDSLIAGFVVVMGVDL
SRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPPANRLPWPV
LCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPLGEDSI
GLKALKPEAEVDEDGVVMCSGPEEGEEVRQAEETGPPSKCQLWSLSGGCGALPQAAMLTP
PQESEMEAPDLDTRGPDGVTPLMSAVCCGEVESRTFQGAWLGCPEPWEPLLDGGACPQAH
TVGTGETPLHLAARFSRPTAARRLIEAGANPNQPDRAGRTPLHAAVAADAREVCQLLLRS
RQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARA
ARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVARQ
RNHWDLLTLLEGAGPLEAHHKATPGREARPFPCARTASVSVPPHGGGALPRCRTLSAGAG
PRGGGACLQARTWSVDLAARGGGAYSYCRSLSGVGAGGVPPPRGRRFSAGMRGPRPNPAI
MRGRYGVAVGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPA
HQEMPKNQGGEGKK
Download sequence
Identical sequences ENSNLEP00000008103 ENSNLEP00000008103 ENSNLEP00000008104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]