SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008132 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008132
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-22
Family V set domains (antibody variable domain-like) 0.00027
Further Details:      
 
Domain Number 2 Region: 247-358
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-21
Family V set domains (antibody variable domain-like) 0.0003
Further Details:      
 
Domain Number 3 Region: 116-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000305
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 
Domain Number 4 Region: 373-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000007
Family C2 set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008132   Gene: ENSNLEG00000006679   Transcript: ENSNLET00000008519
Sequence length 454
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:9218377:9252147:-1 gene:ENSNLEG00000006679 transcript:ENSNLET00000008519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDFPGYSLSGAVASFLFILLTMKQSEDFRVIGPAHPILARVGEDALLTCQLLPKRTAMH
MEVRWYRSEPSTPVFAHRDGVEVTEMQMEEYRGRVEWIENGIAKGNVALKIHNIQPSDNG
QYWCHFQDGNYCGETSLLLKVAGLGSAPNIHMEGPGESGVQLVCTTRGWFPEPQVYWEDI
RGEKLLAMSEHHIQDEDGLFYVEATLVVRNASAESVSCFVHNPILTEEKGSVISLPEKLQ
TELASLKVIGPSKPILVRVGEDIQLTCYLSPKANAQSMEVRWVRSHRYPAVHLYMDGDHV
AGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVG
LGSSPLITVEGQEDGEMLMCSSDGWFPQPHVQWRDMEGKTIPSSSEALTQGSHGLFHVET
LLRVTNISAVDVTCSISISFLGEEKIATFSLSGW
Download sequence
Identical sequences ENSNLEP00000008132 ENSNLEP00000008132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]