SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008135 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008135
Domain Number 1 Region: 68-116
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000000301
Family Elafin-like 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008135   Gene: ENSNLEG00000006687   Transcript: ENSNLET00000008522
Sequence length 117
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:8969034:8970677:1 gene:ENSNLEG00000006687 transcript:ENSNLET00000008522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASSFLIVVVFLIAGMLVVEAAVTGVPVKGQDTVKGRDPFNGQDPVKGQVSVKGQDRVK
GQGPVKGPVSTKPGSCPNILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Download sequence
Identical sequences G1R4L3
ENSNLEP00000008135 XP_003253671.1.23891 ENSNLEP00000008135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]