SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008139 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008139
Domain Number 1 Region: 90-138
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000575
Family Elafin-like 0.00076
Further Details:      
 
Domain Number 2 Region: 37-84
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000196
Family Elafin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008139   Gene: ENSNLEG00000006690   Transcript: ENSNLET00000008526
Sequence length 140
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9025736:9029056:-1 gene:ENSNLEG00000006690 transcript:ENSNLET00000008526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVTPAFTMKSSGLFPLMVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYEKPECQ
SDWQCLGKKRCCPDTCGIKCLDPVDTPNQARRKPGKCPVAYGQCMMLNPPNYCETDGQCE
RGLKCCMGMCGKSCVSPVKA
Download sequence
Identical sequences ENSNLEP00000008139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]