SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008140 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008140
Domain Number 1 Region: 27-109
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.57e-28
Family MHC antigen-recognition domain 0.00000677
Further Details:      
 
Domain Number 2 Region: 110-206
Classification Level Classification E-value
Superfamily Immunoglobulin 9.05e-24
Family C1 set domains (antibody constant domain-like) 0.00000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008140   Gene: ENSNLEG00000006686   Transcript: ENSNLET00000008527
Sequence length 254
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:9284157:9289349:1 gene:ENSNLEG00000006686 transcript:ENSNLET00000008527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSGVPVLGFFIIAVLMRAQESRAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNSTPITNVPPEVTVLTDS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCKVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLIVGLVGIITGTIFIIK
GVRKSNAAERRGPL
Download sequence
Identical sequences G1R4L8
ENSNLEP00000008140 ENSNLEP00000008140 XP_003272196.1.23891 XP_004087145.1.23891 XP_012358646.1.23891 XP_012358647.1.23891 XP_012358648.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]