SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008162 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008162
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.66e-82
Family Mitochondrial carrier 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008162   Gene: ENSNLEG00000006700   Transcript: ENSNLET00000008549
Sequence length 301
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:37092300:37142065:-1 gene:ENSNLEG00000006700 transcript:ENSNLET00000008549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFR
KTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLS
GVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDV
PASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTA
PPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPN
L
Download sequence
Identical sequences A0A2I3H4B1 H2QMK3 O43772
ENSNLEP00000008162 ENSPTRP00000025726 ENSNLEP00000008162 ENSP00000388563 ENSPTRP00000025726 NP_000378.1.87134 NP_000378.1.92137 XP_003257075.1.23891 XP_003818439.1.60992 XP_516446.3.37143 ENSP00000326305 gi|4557403|ref|NP_000378.1| 9598.ENSPTRP00000025726 9606.ENSP00000326305 ENSP00000326305 Hs4557403___KOG0758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]