SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008167 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008167
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.52e-38
Family MHC antigen-recognition domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 124-220
Classification Level Classification E-value
Superfamily Immunoglobulin 4.4e-29
Family C1 set domains (antibody constant domain-like) 0.00000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008167   Gene: ENSNLEG00000006713   Transcript: ENSNLET00000008555
Sequence length 268
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:9547541:9554919:-1 gene:ENSNLEG00000006713 transcript:ENSNLET00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWKMALQIPGSFWAAAVTAMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVA
RYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRT
TLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTSLIR
NGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVLG
LIFLGLGLIIRHRGRKGPRGPPPAGLLH
Download sequence
Identical sequences ENSNLEP00000008167 XP_012358577.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]