SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008184 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008184
Domain Number 1 Region: 289-345
Classification Level Classification E-value
Superfamily RING/U-box 2.47e-18
Family RING finger domain, C3HC4 0.00034
Further Details:      
 
Domain Number 2 Region: 135-222
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000707
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 208-277
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000304
Family IBR domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008184
Domain Number - Region: 381-409
Classification Level Classification E-value
Superfamily DNA-binding domain of Mlu1-box binding protein MBP1 0.0811
Family DNA-binding domain of Mlu1-box binding protein MBP1 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008184   Gene: ENSNLEG00000006710   Transcript: ENSNLET00000008572
Sequence length 493
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:37154077:37225587:1 gene:ENSNLEG00000006710 transcript:ENSNLET00000008572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDMNSQGSDSNEEDYDPNCEEEEEEEDEDPGDIEDYYVGVASDVEQQGADAFDPEEYQ
FTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEA
RVQPNPSKHVPTSHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVG
VSCMAQDCPLRTPEDFVFPLLPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQ
EPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKC
NICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQARE
ALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC
RYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAE
QRRRTLLKDFHDT
Download sequence
Identical sequences G1R4R2 G3SDP4 H2QMK4
ENSNLEP00000008184 XP_003257076.1.23891 XP_003818431.1.60992 XP_004034170.1.27298 XP_008969933.1.60992 XP_012367334.1.23891 ENSPTRP00000025728 ENSPTRP00000025728 ENSNLEP00000008184 9598.ENSPTRP00000025728 ENSGGOP00000026224 ENSGGOP00000016719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]