SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008185 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008185
Domain Number 1 Region: 3157-3331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.68e-31
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2986-3149
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-28
Family Laminin G-like module 0.00099
Further Details:      
 
Domain Number 3 Region: 2587-2759
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-20
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 4 Region: 2758-2927
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.59e-19
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 2386-2577
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000051
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 1355-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1686-1735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 8 Region: 1265-1313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 535-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 10 Region: 1738-1788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000511
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 11 Region: 355-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 12 Region: 298-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.065
Further Details:      
 
Domain Number 13 Region: 490-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 14 Region: 630-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1404-1452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 16 Region: 425-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008185
Domain Number - Region: 683-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 585-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 103-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00189
Family APC10-like 0.06
Further Details:      
 
Domain Number - Region: 1650-1688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 1316-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 2100-2318
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008185   Gene: ENSNLEG00000006636   Transcript: ENSNLET00000008573
Sequence length 3332
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:13554053:13844192:-1 gene:ENSNLEG00000006636 transcript:ENSNLET00000008573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARPRGRAPGPVLPPTPLLLLVLRVLPAWGATARDPGAAAGLSLHPYFNLAEAARIW
ASATCGERGPGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAID
GSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGSTY
SPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGAK
NFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGQCVC
NGHAEVCNVNNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHGH
ASDCYYDPDVERQQASLNTQGIYAGGGVCVNCQHNTAGVNCELCAKGYYRPYGVPVDAPD
GCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAVGYYSFPFCLRIPIFPVSTPSPE
DPVAGDIKGCDCNLEGVLPEMCDAHGWCLCRPGVEGPRCDTCRSGFYSFPICQACWCSAL
GSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSGACDPAGTINSNLGYCQC
KLHVEGPTCSSCKSLYWNLDKENPNGCSECQCHKAGTVSGTGECRQGDGDCHCKSHVGGD
SCDTCEDGYFALEKSNYFGCQGCQCDVGGAWSSVCSGPSGVCQCREHVVGKACQRPENNY
YFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQNDVRITLNVGKSS
GSLFRVILRYINPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFSI
TPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYTGSPQENCLLYQHLPVTR
FPCTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRVPQVGHYVVVVE
YSTEAAQLFVVDVNVKSPGSVLGGQVNIYSCNYSVLCRSAVIDHMSRIAMYELLADADIQ
LKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGQFVNQSATCVSLAHETPPTALIL
DVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAVHPTF
PAQVSVHGGWPRAGSFRASFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSLVL
VRVLAVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYHK
GALPCECHPAGATGPHCSPEGGQCPCRPNVIGRQCTRCATGHYGFPRCKPCSCGRCLCEE
MTGQCRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPECDRDSGQCRCK
PRITGRQCDRCASGFYHFPECVPCNCNRDGTEPGVCDPGTGACLCKANVEGTECNVCREG
SFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWRLETADRVDIPVSFNPGSNS
MVADLQELPATVRSASWVAPTSYLGDKVSSYGGYLTYQAKSFGLPGDMVLLEKKPDVQLT
GQHMSIIYEETNTPRPDRLHHGRVQVVEGNFRHASSRAPVSREELMTVLSRLADVRIQGL
HFTETQRLTLSEVGLEEASDTGSGRIAHAVEMCACPPAYAGDSCQGCSPGYYRDHKGLYT
GRCVPCNCNGHSNRCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNS
FATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGQLGSCDPL
TGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQMR
HMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLYN
NVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSREWAEAQRMMRELR
NRNFGKHLREAEADKRESQLLLNRIRTWLKTHQGENNGLANSIRDSLNEYEAKLSDLRAR
LQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTNADSSLLQTNIALQLL
EKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHAQSLQELAKQLEEIKR
NASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLSS
NSDKLLNEAKMTQKKLKQEVSPALNNLQQTLTIVTVQKEVIDTNLTTLRDGLRGIQRGDI
DAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGSTQNEDFKKALTDADNSVNK
LTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGVEV
RLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLTCV
YNLGDREAELQVDQILTKSEIQEAVMDRVKFQRIYQFARLNYTKGATSSKPETPGVYDMD
GRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNENVLSLYNFKKTF
NLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPYAPIPTFGQTIQTTVDRGLLFFAENG
DRFISLNIEDGKLMVRYKLNSEPPKERGVGDAINNGRDHSIQIKIGKLQKRMWINVDVQN
TIIDGEVFDFNTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKKCS
EDWKLVRSASFSRGGQLSFTNLGLPPTDHLQASFGFQTFEPSGILLNHQTRTSSLQVTLE
DGYIELSTRDSGGPIFKSPQTYMDGLLHYVSVISDSSGLRLLIDDQPLRNNGRLKPISSS
QQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNTPPFLMLLKGS
TRFNKTKTFRINQLLQDTPVASPRSMKVWQDACSPLPRTQANHGALQFGDIPTSHLLFKL
PQELLKPRSQFAVDMQTTSSRGLVFHMGTKNSFMALYLSKGRLVFALGTDGKKLRIKSKE
KCNDGKWHMVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKPKSLPT
NSFVGCLKNFQLDSKPLDTPSSSFGVSSCLGGPLEKGIYFSEEGGHVVLAHSVLLGPEFK
LVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDGQW
HSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTLRIPVWKSFFG
CLRNIHVNHISVPATEALEVQGPVSLNGCPDH
Download sequence
Identical sequences ENSNLEP00000008185 ENSNLEP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]