SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008209 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008209
Domain Number 1 Region: 76-122
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000366
Family Elafin-like 0.00042
Further Details:      
 
Domain Number 2 Region: 29-73
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000222
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008209   Gene: ENSNLEG00000006742   Transcript: ENSNLET00000008597
Sequence length 124
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9287352:9299353:1 gene:ENSNLEG00000006742 transcript:ENSNLET00000008597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACRLGPLAAALLLGLLLFGFTLVPGTGAEKTGMCPELQADQNCTQECVSDSECADNLK
CCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV
TPNF
Download sequence
Identical sequences G1R4T7
XP_003253688.1.23891 ENSNLEP00000008209 ENSNLEP00000008209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]