SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008214 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008214
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily BPTI-like 1.05e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 2 Region: 31-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000196
Family Elafin-like 0.0029
Further Details:      
 
Domain Number 3 Region: 134-171
Classification Level Classification E-value
Superfamily Elafin-like 0.0000314
Family Elafin-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008214   Gene: ENSNLEG00000006746   Transcript: ENSNLET00000008602
Sequence length 179
Comment pep:novel supercontig:Nleu1.0:GL397262.1:9356815:9366645:-1 gene:ENSNLEG00000006746 transcript:ENSNLET00000008602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLLSLLVLFILLANVQGPGLTDWLFPRRCPKIREECGFKERDVCTKDRQCQDNKKC
CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLRWWYDKKNNTCSMFVYGGCPGNNNNFQSK
ANCLNTCKNKQPRPKIKVECKVEEIDQCTKPRDCPENMKCCLFSRGKKCLDLRKVTQML
Download sequence
Identical sequences ENSNLEP00000008214 ENSNLEP00000008214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]