SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008222 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008222
Domain Number 1 Region: 394-550
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-29
Family Toll/Interleukin receptor TIR domain 0.00051
Further Details:      
 
Domain Number 2 Region: 32-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000153
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 242-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000017
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 155-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000549
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008222   Gene: ENSNLEG00000006747   Transcript: ENSNLET00000008610
Sequence length 570
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:44608836:44749815:1 gene:ENSNLEG00000006747 transcript:ENSNLET00000008610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAATVKQKVPAPRYTVEL
ACGFGATILLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
Download sequence
Identical sequences G1R4V0
ENSNLEP00000008222 XP_003256703.1.23891 XP_003256704.1.23891 XP_003256705.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]